SCOPe 2.06: Domain d5verb_: 5ver B:

Lineage for d5verb_ (5ver B:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
   main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest

4. Superfamily c.67.1: PLP-dependent transferases [53383] (10 families)

5. Family c.67.1.0: automated matches [191328] (1 protein)
   not a true family

6. Protein automated matches [190151] (121 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188700] (8 PDB entries)

8. Domain d5verb_: 5ver B: [342201]
   automated match to d3e2ya_
   complexed with ca, epe, gol, peg, pge, plp, pmp

Details for d5verb_

PDB Entry: 5ver, 2.81 Å

PDB Description: mouse kynurenine aminotransferase iii, re-refinement of the pdb structure 3e2z

PDB Compounds: (B:) Kynurenine--oxoglutarate transaminase 3

SCOPe Domain Sequences for d5verb_:

Sequence; same for both SEQRES and ATOM records:

>d5verb_ c.67.1.0 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
nakriegldsnvwveftklaadpsvvnlgqgfpdisppsyvkeelskaafidnmnqytrg
fghpalvkalsclygkiyqrqidpneeilvavgaygslfnsiqglvdpgdeviimvpfyd
cyepmvrmagavpvfiplrskptdgmkwtssdwtfdpreleskfssktkaiilntphnpl
gkvytrqelqviadlcvkhdtlcisdevyewlvytghthvkiatlpgmwertitigsagk
tfsvtgwklgwsigpahlikhlqtvqqnsfytcatplqaalaeafwidikrmddpecyfn
slpkelevkrdrmvrllnsvglkpivpdggyfiiadvsslgadlsdmnsdepydykfvkw
mtkhkkltaipvsafcdskskphfeklvrfcfikkdstldaaeeifrawn

Timeline for d5verb_:

• d5verb_ is new in SCOPe 2.06-stable
  
• d5verb_ appears in SCOPe 2.07
  
• d5verb_ appears in the current release, SCOPe 2.08