Lineage for d1qama_ (1qam A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1864482Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 1864483Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (58 families) (S)
  5. 1865082Family c.66.1.24: rRNA adenine dimethylase-like [88784] (5 proteins)
  6. 1865090Protein rRNA adenine dimethylase [53363] (2 species)
    contains additional all-alpha C-terminal domain (res.181-248)
  7. 1865091Species Bacillus subtilis, Ermc' [TaxId:1423] [53365] (5 PDB entries)
  8. 1865092Domain d1qama_: 1qam A: [34220]
    complexed with act

Details for d1qama_

PDB Entry: 1qam (more details), 2.2 Å

PDB Description: the structure of the rrna methyltransferase ermc': implications for the reaction mechanism
PDB Compounds: (A:) ermc' methyltransferase

SCOPe Domain Sequences for d1qama_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qama_ c.66.1.24 (A:) rRNA adenine dimethylase {Bacillus subtilis, Ermc' [TaxId: 1423]}
qnfitskhnidkimtnirlnehdnifeigsgkghftlelvqrcnfvtaieidhklcktte
nklvdhdnfqvlnkdilqfkfpknqsykifgnipynistdiirkivfdsiadeiylivey
gfakrllntkrslalflmaevdisilsmvpreyfhpkpkvnsslirlnrkksrishkdkq
kynyfvmkwvnkeykkiftknqfnnslkhagiddlnnisfeqflslfnsyklfnk

SCOPe Domain Coordinates for d1qama_:

Click to download the PDB-style file with coordinates for d1qama_.
(The format of our PDB-style files is described here.)

Timeline for d1qama_: