![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
![]() | Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) ![]() |
![]() | Family c.66.1.24: rRNA adenine dimethylase-like [88784] (5 proteins) |
![]() | Protein rRNA adenine dimethylase [53363] (2 species) contains additional all-alpha C-terminal domain (res.181-248) |
![]() | Species Bacillus subtilis, Ermc' [TaxId:1423] [53365] (5 PDB entries) |
![]() | Domain d1qama_: 1qam A: [34220] complexed with act |
PDB Entry: 1qam (more details), 2.2 Å
SCOPe Domain Sequences for d1qama_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qama_ c.66.1.24 (A:) rRNA adenine dimethylase {Bacillus subtilis, Ermc' [TaxId: 1423]} qnfitskhnidkimtnirlnehdnifeigsgkghftlelvqrcnfvtaieidhklcktte nklvdhdnfqvlnkdilqfkfpknqsykifgnipynistdiirkivfdsiadeiylivey gfakrllntkrslalflmaevdisilsmvpreyfhpkpkvnsslirlnrkksrishkdkq kynyfvmkwvnkeykkiftknqfnnslkhagiddlnnisfeqflslfnsyklfnk
Timeline for d1qama_: