Lineage for d5y8ta_ (5y8t A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2694554Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 2694555Protein automated matches [190154] (92 species)
    not a true protein
  7. 2694612Species Bacillus subtilis [TaxId:655816] [341938] (5 PDB entries)
  8. 2694617Domain d5y8ta_: 5y8t A: [342194]
    automated match to d1yg2a_
    complexed with hc4

Details for d5y8ta_

PDB Entry: 5y8t (more details), 2 Å

PDB Description: crystal structure of bacillus subtilis padr in complex with p-coumaric acid
PDB Compounds: (A:) Transcriptional regulator

SCOPe Domain Sequences for d5y8ta_:

Sequence, based on SEQRES records: (download)

>d5y8ta_ a.4.5.0 (A:) automated matches {Bacillus subtilis [TaxId: 655816]}
rvlkyailgllrkgelsgyditsyfkeelgqfwsakhsqiypelkkltdegfitfrttiq
gtklekkmytltdsgkqelhdwlirhqpipetvkdefmlkayfisslsrqeasdlftdql
lkrkaklsdlqgsyeklmasaepmsfsspdfghylvltkalereknyvswlesilamid

Sequence, based on observed residues (ATOM records): (download)

>d5y8ta_ a.4.5.0 (A:) automated matches {Bacillus subtilis [TaxId: 655816]}
rvlkyailgllrkgelsgyditsyfkeelgqfwsakhsqiypelkkltdegfitytltds
gkqelhdwlirhqpipetvkdefmlkayfisslsrqeasdlftdqllkrkaklsdlqgsy
eklmapmsfsspdfghylvltkalereknyvswlesilamid

SCOPe Domain Coordinates for d5y8ta_:

Click to download the PDB-style file with coordinates for d5y8ta_.
(The format of our PDB-style files is described here.)

Timeline for d5y8ta_: