SCOPe 2.08: Domain d5xkub2: 5xku B:105-209

Lineage for d5xkub2 (5xku B:105-209)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)

8. Domain d5xkub2: 5xku B:105-209 [342180]
   Other proteins in same PDB: d5xkub1, d5xkuc1, d5xkuc2
   automated match to d1dn0a2
   complexed with nag

Details for d5xkub2

PDB Entry: 5xku, 1.78 Å

PDB Description: crystal structure of hemagglutinin globular head from an h7n9 influenza virus in complex with a neutralizing antibody hnigga6

PDB Compounds: (B:) HNIgGA6 light chain

SCOPe Domain Sequences for d5xkub2:

Sequence; same for both SEQRES and ATOM records:

>d5xkub2 b.1.1.2 (B:105-209) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnr

Timeline for d5xkub2:

• d5xkub2 first appeared in SCOPe 2.06
  
• d5xkub2 appears in SCOPe 2.07