Lineage for d1av6a_ (1av6 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2129295Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2129296Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2129933Family c.66.1.25: mRNA cap methylase [88785] (3 protein domains)
  6. 2129955Protein Polymerase regulatory subunit VP39 [53361] (2 species)
  7. 2129960Species Vaccinia virus [TaxId:10245] [53362] (17 PDB entries)
  8. 2129976Domain d1av6a_: 1av6 A: [34218]
    protein/RNA complex; complexed with mgt, sah

Details for d1av6a_

PDB Entry: 1av6 (more details), 2.8 Å

PDB Description: vaccinia methyltransferase vp39 complexed with m7g capped rna hexamer and s-adenosylhomocysteine
PDB Compounds: (A:) Cap-specific mRNA (nucleoside-2'-O-)-methyltransferase

SCOPe Domain Sequences for d1av6a_:

Sequence, based on SEQRES records: (download)

>d1av6a_ c.66.1.25 (A:) Polymerase regulatory subunit VP39 {Vaccinia virus [TaxId: 10245]}
vvsldkpfmyfeeidneldyepesanevakklpyqgqlklllgelfflsklqrhgildga
tvvyigsapgthirylrdhfynlgviikwmlidgrhhdpilnglrdvtlvtrfvdeeylr
sikkqlhpskiilisdvrskrggnepstadllsnyalqnvmisilnpvasslkwrcpfpd
qwikdfyiphgnkmlqpfapsysaemrllsiytgenmrltrvtksdavnyekkmyylnki
vrnkvvvnfdypnqeydyfhmyfmlrtvycnktfpttkakvlflqqsifrflnip

Sequence, based on observed residues (ATOM records): (download)

>d1av6a_ c.66.1.25 (A:) Polymerase regulatory subunit VP39 {Vaccinia virus [TaxId: 10245]}
vvsldkpfmyfeeidneldyepesanevakklpyqgqlklllgelfflsklqrhgildga
tvvyigsapgthirylrdhfynlgviikwmlidgrhhdpilnglrdvtlvtrfvdeeylr
sikkqlhpskiilisdvrspstadllsnyalqnvmisilnpvasslkwrcpfpdqwikdf
yiphgnkmlqpfapsysaemrllsiytgenmrltrvtksdavnyekkmyylnkivrnkvv
vnfdypnqeydyfhmyfmlrtvycnktfpttkakvlflqqsifrflnip

SCOPe Domain Coordinates for d1av6a_:

Click to download the PDB-style file with coordinates for d1av6a_.
(The format of our PDB-style files is described here.)

Timeline for d1av6a_: