Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies) main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest |
Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) |
Family c.67.1.0: automated matches [191328] (1 protein) not a true family |
Protein automated matches [190151] (166 species) not a true protein |
Species Plasmodium vivax [TaxId:126793] [261543] (24 PDB entries) |
Domain d5xmvb_: 5xmv B: [342175] automated match to d4pffa_ complexed with 8au, cl, plg |
PDB Entry: 5xmv (more details), 2.16 Å
SCOPe Domain Sequences for d5xmvb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5xmvb_ c.67.1.0 (B:) automated matches {Plasmodium vivax [TaxId: 126793]} mfnnepleqidkelhdiladeekrqretinliasenltngavreclgnrvsnkysegypk kryyggndfidkieelcqkraleafnvsdeewgvnvqplsgsaanvqalyalvgvkgkim gmhlcsgghlthgffdekkkvsitsdmfesklykcnsqgyvdldavremalsfkpkviic gytsyprdidyqqfrqicdevnaylfadishissfvacnilnnpflhadvvtttthkilr gprsaliffnkkrnpgieqkinsavfpsfqggphnnkiaavacqlkevhspafkeytqqv llnskalakaliskqidlvtngtdnhlivvdlrkfsitgsklqetcnainvslnkntips dvdcvspsgvrigtpamttrgakekdmefiadvlaraikitvdlqeqygkklvdfkkglp gnaqlqqlkqevvtwagalpfp
Timeline for d5xmvb_: