SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d3mcta_ (3mct A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2129295Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2129296Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2129933Family c.66.1.25: mRNA cap methylase [88785] (3 protein domains)
  6. 2129955Protein Polymerase regulatory subunit VP39 [53361] (2 species)
  7. 2129960Species Vaccinia virus [TaxId:10245] [53362] (17 PDB entries)
  8. 2129972Domain d3mcta_: 3mct A: [34215]
    protein/RNA complex; complexed with 3mc, sah

Details for d3mcta_

PDB Entry: 3mct (more details), 2 Å

PDB Description: vaccinia methyltransferase vp39 complexed with m3cyt and s-adenosylhomocysteine
PDB Compounds: (A:) vp39

SCOPe Domain Sequences for d3mcta_:

Sequence, based on SEQRES records: (download)

>d3mcta_ c.66.1.25 (A:) Polymerase regulatory subunit VP39 {Vaccinia virus [TaxId: 10245]}
mdvvsldkpfmyfeeidneldyepesanevakklpyqgqlklllgelfflsklqrhgild
gatvvyigsapgthirylrdhfynlgviikwmlidgrhhdpilnglrdvtlvtrfvdeey
lrsikkqlhpskiilisdvrskrggnepstadllsnyalqnvmisilnpvasslkwrcpf
pdqwikdfyiphgnkmlqpfapsysaemrllsiytgenmrltrvtksdavnyekkmyyln
kivrnkvvvnfdypnqeydyfhmyfmlrtvycnktfpttkakvlflqqsifrflnip

Sequence, based on observed residues (ATOM records): (download)

>d3mcta_ c.66.1.25 (A:) Polymerase regulatory subunit VP39 {Vaccinia virus [TaxId: 10245]}
mdvvsldkpfmyfeeidneldyepesanevakklpyqgqlklllgelfflsklqrhgild
gatvvyigsapgthirylrdhfynlgviikwmlidgrhhdpilnglrdvtlvtrfvdeey
lrsikkqlhpskiilisdvrspstadllsnyalqnvmisilnpvasslkwrcpfpdqwik
dfyiphgnkmlqpfapsysaemrllsiytgenmrltrvtksdavnyekkmyylnkivrnk
vvvnfdypnqeydyfhmyfmlrtvycnktfpttkakvlflqqsifrflnip

SCOPe Domain Coordinates for d3mcta_:

Click to download the PDB-style file with coordinates for d3mcta_.
(The format of our PDB-style files is described here.)

Timeline for d3mcta_: