![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.262: PriB N-terminal domain-like [140913] (1 superfamily) multihelical bundle; contains buried central helix; also includes the PriA interface-forming insert subdomain (alpha+beta) |
![]() | Superfamily a.262.1: PriB N-terminal domain-like [140914] (1 family) ![]() |
![]() | Family a.262.1.1: PriB N-terminal domain-like [140915] (2 proteins) |
![]() | Protein automated matches [342146] (1 species) not a true protein |
![]() | Species Sulfolobus solfataricus [TaxId:2287] [342147] (1 PDB entry) |
![]() | Domain d5ofnb_: 5ofn B: [342148] Other proteins in same PDB: d5ofna_ automated match to d1zt2b1 complexed with zn |
PDB Entry: 5ofn (more details), 3.01 Å
SCOPe Domain Sequences for d5ofnb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ofnb_ a.262.1.1 (B:) automated matches {Sulfolobus solfataricus [TaxId: 2287]} ldvkkypfikslddelkkygggitltdlllnsttlidqakdriqktksgdelphyvsyne pvlvfyttllslailndvklirryayaeakqfrsllhteneenlleisklldlkinrcdp ikfylekkrriiqkefcvhfidylkytkdlkedwklsgqilhkgyvyldknqligliaes ikskivemirplnlkeipeklkslie
Timeline for d5ofnb_: