Lineage for d1bky__ (1bky -)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 26076Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
  4. 26077Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (11 families) (S)
  5. 26129Family c.66.1.9: RNA methylases [53360] (2 proteins)
  6. 26130Protein Polymerase regulatory subunit VP39 [53361] (1 species)
  7. 26131Species Vaccinia virus [TaxId:10245] [53362] (14 PDB entries)
  8. 26141Domain d1bky__: 1bky - [34214]

Details for d1bky__

PDB Entry: 1bky (more details), 2 Å

PDB Description: vaccinia methyltransferase vp39 complexed with m1cyt and s-adenosylhomocysteine

SCOP Domain Sequences for d1bky__:

Sequence, based on SEQRES records: (download)

>d1bky__ c.66.1.9 (-) Polymerase regulatory subunit VP39 {Vaccinia virus}
mdvvsldkpfmyfeeidneldyepesanevakklpyqgqlklllgelfflsklqrhgild
gatvvyigsapgthirylrdhfynlgviikwmlidgrhhdpilnglrdvtlvtrfvdeey
lrsikkqlhpskiilisdvrskrggnepstadllsnyalqnvmisilnpvasslkwrcpf
pdqwikdfyiphgnkmlqpfapsysaemrllsiytgenmrltrvtksdavnyekkmyyln
kivrnkvvvnfdypnqeydyfhmyfmlrtvycnktfpttkakvlflqqsifrflnip

Sequence, based on observed residues (ATOM records): (download)

>d1bky__ c.66.1.9 (-) Polymerase regulatory subunit VP39 {Vaccinia virus}
mdvvsldkpfmyfeeidneldyepesanevakklpyqgqlklllgelfflsklqrhgild
gatvvyigsapgthirylrdhfynlgviikwmlidgrhhdpilnglrdvtlvtrfvdeey
lrsikkqlhpskiilisdvrspstadllsnyalqnvmisilnpvasslkwrcpfpdqwik
dfyiphgnkmlqpfapsysaemrllsiytgenmrltrvtksdavnyekkmyylnkivrnk
vvvnfdypnqeydyfhmyfmlrtvycnktfpttkakvlflqqsifrflnip

SCOP Domain Coordinates for d1bky__:

Click to download the PDB-style file with coordinates for d1bky__.
(The format of our PDB-style files is described here.)

Timeline for d1bky__: