Class b: All beta proteins [48724] (177 folds) |
Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily) sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds |
Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families) |
Family b.96.1.1: Nicotinic receptor ligand binding domain-like [63713] (2 proteins) automatically mapped to Pfam PF02931 |
Protein automated matches [190922] (2 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [189722] (6 PDB entries) |
Domain d5ouhb_: 5ouh B: [342138] automated match to d5afna_ complexed with bma, dms, l0b, man, nag |
PDB Entry: 5ouh (more details), 2.5 Å
SCOPe Domain Sequences for d5ouhb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ouhb_ b.96.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} gefqrklykelvknynpdviptqrdrpvtvyfslsllqimdvdeknqvvdvviwlqmswt dhylqwnvseypgvkqvsvpisslwkpdillynaierpevltpqlalvnssghvqylpsi rqrfscdvsgvdtesgatcklkfgswthhsreldlqmqeadisgyipysrfelvgvtqkr serfyecckepypdvtftvtfrkkg
Timeline for d5ouhb_:
View in 3D Domains from other chains: (mouse over for more information) d5ouha_, d5ouhc_, d5ouhd_, d5ouhe_ |