SCOPe 2.08: Domain d5owja3: 5owj A:248-432

Lineage for d5owja3 (5owj A:248-432)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.223: Triger factor/SurA peptide-binding domain-like [109997] (1 superfamily)
   multihelical; irregular array of long and short helices

4. Superfamily a.223.1: Triger factor/SurA peptide-binding domain-like [109998] (3 families)
   there are sequence and functional similarities between the families, but their structural similarity is obscured by conformational flexibility (in the TF family)

5. Family a.223.1.0: automated matches [256442] (1 protein)
   not a true family

6. Protein automated matches [256443] (3 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [342133] (2 PDB entries)

8. Domain d5owja3: 5owj A:248-432 [342137]
   Other proteins in same PDB: d5owja1, d5owja2, d5owjb1, d5owjb2
   automated match to d1w26a1

Details for d5owja3

PDB Entry: 5owj

PDB Description: the dynamic dimer structure of the chaperone trigger factor (conformer 2)

PDB Compounds: (A:) Trigger Factor

SCOPe Domain Sequences for d5owja3:

Sequence; same for both SEQRES and ATOM records:

>d5owja3 a.223.1.0 (A:248-432) automated matches {Escherichia coli [TaxId: 562]}
ltaefikrfgvedgsveglraevrknmerelksairnrvksqaieglvkandidvpaali
dseidvlrrqaaqrfggnekqalelprelfeeqakrrvvvglllgevirtnelkadeerv
kglieemasayedpkeviefysknkelmdnmrnvaleeqaveavlakakvtekettfnel
mnqqa

Timeline for d5owja3:

• d5owja3 first appeared in SCOPe 2.06
  
• d5owja3 appears in SCOPe 2.07