| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.26: FKBP-like [54533] (3 superfamilies) core: beta(2)-alpha-beta(2); antiparallel beta-sheet |
Superfamily d.26.1: FKBP-like [54534] (4 families) ![]() |
| Family d.26.1.0: automated matches [191631] (1 protein) not a true family |
| Protein automated matches [191162] (29 species) not a true protein |
| Species Escherichia coli [TaxId:562] [225399] (3 PDB entries) |
| Domain d5owja2: 5owj A:132-247 [342136] Other proteins in same PDB: d5owja1, d5owja3, d5owjb1, d5owjb3 automated match to d1w26a3 |
PDB Entry: 5owj (more details)
SCOPe Domain Sequences for d5owja2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5owja2 d.26.1.0 (A:132-247) automated matches {Escherichia coli [TaxId: 562]}
vtdadvdgmldtlrkqqatwkekdgaveaedrvtidftgsvdgeefeggkasdfvlamgq
grmipgfedgikghkageeftidvtfpeeyhaenlkgkaakfainlkkveerelpe
Timeline for d5owja2: