Lineage for d5owja2 (5owj A:132-247)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2941336Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 2941337Superfamily d.26.1: FKBP-like [54534] (4 families) (S)
  5. 2941690Family d.26.1.0: automated matches [191631] (1 protein)
    not a true family
  6. 2941691Protein automated matches [191162] (29 species)
    not a true protein
  7. 2941738Species Escherichia coli [TaxId:562] [225399] (3 PDB entries)
  8. 2941747Domain d5owja2: 5owj A:132-247 [342136]
    Other proteins in same PDB: d5owja1, d5owja3, d5owjb1, d5owjb3
    automated match to d1w26a3

Details for d5owja2

PDB Entry: 5owj (more details)

PDB Description: the dynamic dimer structure of the chaperone trigger factor (conformer 2)
PDB Compounds: (A:) Trigger Factor

SCOPe Domain Sequences for d5owja2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5owja2 d.26.1.0 (A:132-247) automated matches {Escherichia coli [TaxId: 562]}
vtdadvdgmldtlrkqqatwkekdgaveaedrvtidftgsvdgeefeggkasdfvlamgq
grmipgfedgikghkageeftidvtfpeeyhaenlkgkaakfainlkkveerelpe

SCOPe Domain Coordinates for d5owja2:

Click to download the PDB-style file with coordinates for d5owja2.
(The format of our PDB-style files is described here.)

Timeline for d5owja2: