SCOPe 2.07: Domain d5owja1: 5owj A:1-131

Lineage for d5owja1 (5owj A:1-131)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.241: Ribosome binding domain-like [100965] (2 superfamilies)
   beta-(2)-alpha(2)-beta(2); 2 layers: beta/alpha; antiparallel beta-sheet: order 1243; topological similarity to the common core of ribosomal proteins L23 and L15e

4. Superfamily d.241.2: Trigger factor ribosome-binding domain [102735] (2 families)
   automatically mapped to Pfam PF05697

5. Family d.241.2.0: automated matches [256436] (1 protein)
   not a true family

6. Protein automated matches [256437] (3 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [342130] (2 PDB entries)

8. Domain d5owja1: 5owj A:1-131 [342135]
   Other proteins in same PDB: d5owja2, d5owja3, d5owjb2, d5owjb3
   automated match to d1w26a2

Details for d5owja1

PDB Entry: 5owj

PDB Description: the dynamic dimer structure of the chaperone trigger factor (conformer 2)

PDB Compounds: (A:) Trigger Factor

SCOPe Domain Sequences for d5owja1:

Sequence; same for both SEQRES and ATOM records:

>d5owja1 d.241.2.0 (A:1-131) automated matches {Escherichia coli [TaxId: 562]}
mqvsvettqglgrrvtitiaadsietavkselvnvakkvridgfrkgkvpmnivaqryga
svrqdvlgdlmsrnfidaiikekinpagaptyvpgeyklgedftysvefevypevelqgl
eaievekpive

Timeline for d5owja1:

• d5owja1 first appeared in SCOPe 2.06
  
• d5owja1 appears in the current release, SCOPe 2.08