Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.22: GFP-like [54510] (1 superfamily) beta-sheet folds into a barrel (n=11, S=14) around the central helix |
Superfamily d.22.1: GFP-like [54511] (3 families) |
Family d.22.1.1: Fluorescent proteins [54512] (6 proteins) |
Protein automated matches [190406] (22 species) not a true protein |
Species Vaccinia virus [TaxId:10245] [342120] (3 PDB entries) |
Domain d5oxca_: 5oxc A: [342121] automated match to d3st3a_ |
PDB Entry: 5oxc (more details), 1.02 Å
SCOPe Domain Sequences for d5oxca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5oxca_ d.22.1.1 (A:) automated matches {Vaccinia virus [TaxId: 10245]} mvskgeelftgvvpilveldgdvnghkfsvsgegegdatygkltlkficttgklpvpwpt lvttlxvqcfarypdhmkqhdffksampegyvqertiffkddgnyktraevkfegdtlvn rielkgidfkedgnilghkleynaisdnvyitadkqkngikanfkirhniedgsvqladh yqqntpigdgpvllpdnhylstqsalskdpnekrdhmvllefvtaagitl
Timeline for d5oxca_: