Lineage for d1eama_ (1eam A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2129295Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2129296Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2129933Family c.66.1.25: mRNA cap methylase [88785] (3 protein domains)
  6. 2129955Protein Polymerase regulatory subunit VP39 [53361] (2 species)
  7. 2129960Species Vaccinia virus [TaxId:10245] [53362] (17 PDB entries)
  8. 2129969Domain d1eama_: 1eam A: [34212]
    complexed with sah; mutant

Details for d1eama_

PDB Entry: 1eam (more details), 2 Å

PDB Description: vaccinia methyltransferase vp39 mutant (ec: 2.7.7.19)
PDB Compounds: (A:) protein (vp39)

SCOPe Domain Sequences for d1eama_:

Sequence, based on SEQRES records: (download)

>d1eama_ c.66.1.25 (A:) Polymerase regulatory subunit VP39 {Vaccinia virus [TaxId: 10245]}
mdvvsldkpfmyfeeidneldyepesanevakklpyqgqlklllgelfflsklqrhgild
gatvvyigsapgthirylrdhfynlgviikwmlidgrhhdpilnglrdvtlvtrfvdeey
lrsikkqlhpskiilisdvrskrggnepstadllsnyalqnvmisilnpvasslkwrcpf
pdqwikdfyiphgnkmlqpfapsysaemrllsiytgenmrltrvtksdavnyakkmyyln
kivrnkvvvnfdypnqeydyfhmyfmlrtvycnktfpttkakvlflqqsifrflnip

Sequence, based on observed residues (ATOM records): (download)

>d1eama_ c.66.1.25 (A:) Polymerase regulatory subunit VP39 {Vaccinia virus [TaxId: 10245]}
mdvvsldkpfmyfeeidneldyepakklpyqgqlklllgelfflsklqrhgildgatvvy
igsapgthirylrdhfynlgviikwmlidgrhhdpilnglrdvtlvtrfvdeeylrsikk
qlhpskiilisdvrspstadllsnyalqnvmisilnpvasslkwrcpfpdqwikdfyiph
gnkmlqpfapsysaemrllsiytgenmrltrvtksdavnyakkmyylnkivrnkvvvnfd
ypnqeydyfhmyfmlrtvycnktfpttkakvlflqqsifrflnip

SCOPe Domain Coordinates for d1eama_:

Click to download the PDB-style file with coordinates for d1eama_.
(The format of our PDB-style files is described here.)

Timeline for d1eama_: