SCOPe 2.08: Domain d5onya1: 5ony A:2-159

Lineage for d5onya1 (5ony A:2-159)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.3: Multidomain cupredoxins [49550] (15 proteins)

6. Protein automated matches [226877] (4 species)
   not a true protein

7. Species Alcaligenes xylosoxydans [TaxId:85698] [225578] (6 PDB entries)

8. Domain d5onya1: 5ony A:2-159 [342104]
   automated match to d1gs7a1
   complexed with cu, mes, pg4, zn

Details for d5onya1

PDB Entry: 5ony, 1.6 Å

PDB Description: as-isolated resting state copper nitrite reductase from achromobacter xylosoxidans

PDB Compounds: (A:) Copper-containing nitrite reductase

SCOPe Domain Sequences for d5onya1:

Sequence; same for both SEQRES and ATOM records:

>d5onya1 b.6.1.3 (A:2-159) automated matches {Alcaligenes xylosoxydans [TaxId: 85698]}
dadklphtkvtlvappqvhpheqatksgpkvveftmtieekkmviddkgttlqamtfngs
mpgptlvvhegdyvqltlvnpatnamphnvdfhgatgalggakltnvnpgeqatlrfkad
rsgtfvyhcapegmvpwhvvsgmsgtlmvlprdglkdp

Timeline for d5onya1:

• d5onya1 first appeared in SCOPe 2.06
  
• d5onya1 appears in SCOPe 2.07