SCOPe 2.08: Domain d5oj7a1: 5oj7 A:32-315

Lineage for d5oj7a1 (5oj7 A:32-315)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like

4. Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (7 families)
   binds cofactor molecules in the opposite direction than classical Rossmann fold

5. Family c.31.1.0: automated matches [191352] (1 protein)
   not a true family

6. Protein automated matches [190312] (14 species)
   not a true protein

7. Species Western clawed frog (Xenopus tropicalis) [TaxId:8364] [342089] (2 PDB entries)

8. Domain d5oj7a1: 5oj7 A:32-315 [342090]
   Other proteins in same PDB: d5oj7a2
   automated match to d2b4ya1
   complexed with ar6, edo, gol, zn

Details for d5oj7a1

PDB Entry: 5oj7, 1.58 Å

PDB Description: sirtuin 4 orthologue from xenopus tropicalis in complex with adp- ribose

PDB Compounds: (A:) NAD-dependent protein deacylase

SCOPe Domain Sequences for d5oj7a1:

Sequence; same for both SEQRES and ATOM records:

>d5oj7a1 c.31.1.0 (A:32-315) automated matches {Western clawed frog (Xenopus tropicalis) [TaxId: 8364]}
vpacpppnphqveqlqdfvsqsqrlfvmtgagistesgipdyrsegvglysrterrpiqh
sefvqsqaarrrywarnfvgwpsfsshepnsahvnlckweragrlhwlvtqnvdalhtka
gqcrlselhgcthrviclgcqtvtkrselqerflnlnpswneqahglapdgdvfltdeqv
sdfqvpactkcggilkpqvtffgdtvnrgfvfsiyeqmkqadamlivgsslqvysgyrfa
lnakelhlpiailnigptradhlakvkvsarcgdvlphillqdq

Timeline for d5oj7a1:

• d5oj7a1 first appeared in SCOPe 2.06
  
• d5oj7a1 appears in SCOPe 2.07