SCOPe 2.06: Domain d5oefb2: 5oef B:127-209

Lineage for d5oefb2 (5oef B:127-209)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families)

5. Family d.58.1.0: automated matches [229598] (1 protein)
   not a true family

6. Protein automated matches [229599] (3 species)
   not a true protein

7. Species Clostridium pasteurianum [TaxId:1501] [279205] (7 PDB entries)

8. Domain d5oefb2: 5oef B:127-209 [342087]
   Other proteins in same PDB: d5oefa1, d5oefa3, d5oefb1, d5oefb3
   automated match to d3c8ya3
   complexed with 9sq, fes, mg, sf4

Details for d5oefb2

PDB Entry: 5oef, 2.05 Å

PDB Description: active semisynthetic [fefe]-hydrogenase cpi with aza-diselenato- bridged [2fe] cofactor

PDB Compounds: (B:) Iron hydrogenase 1

SCOPe Domain Sequences for d5oefb2:

Sequence; same for both SEQRES and ATOM records:

>d5oefb2 d.58.1.0 (B:127-209) automated matches {Clostridium pasteurianum [TaxId: 1501]}
kdkteyvdersksltvdrtkcllcgrcvnacgkntetyamkflnkngktiigaedekcfd
dtncllcgqciiacpvaalseks

Timeline for d5oefb2:

• d5oefb2 is new in SCOPe 2.06-stable
  
• d5oefb2 appears in SCOPe 2.07
  
• d5oefb2 appears in the current release, SCOPe 2.08