Lineage for d5oefb1 (5oef B:2-126)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2933780Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) (S)
  5. 2934202Family d.15.4.0: automated matches [191632] (1 protein)
    not a true family
  6. 2934203Protein automated matches [191164] (24 species)
    not a true protein
  7. 2934207Species Clostridium pasteurianum [TaxId:1501] [279203] (17 PDB entries)
  8. 2934227Domain d5oefb1: 5oef B:2-126 [342086]
    Other proteins in same PDB: d5oefa2, d5oefa3, d5oefb2, d5oefb3
    automated match to d3c8ya2
    complexed with 9sq, fes, mg, sf4

Details for d5oefb1

PDB Entry: 5oef (more details), 2.05 Å

PDB Description: active semisynthetic [fefe]-hydrogenase cpi with aza-diselenato- bridged [2fe] cofactor
PDB Compounds: (B:) Iron hydrogenase 1

SCOPe Domain Sequences for d5oefb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5oefb1 d.15.4.0 (B:2-126) automated matches {Clostridium pasteurianum [TaxId: 1501]}
ktiiingvqfntdedttilkfardnnidisalcflnncnndinkceictvevegtglvta
cdtliedgmiintnsdavnekiksrisqlldihefkcgpcnrrenceflklvikykaras
kpflp

SCOPe Domain Coordinates for d5oefb1:

Click to download the PDB-style file with coordinates for d5oefb1.
(The format of our PDB-style files is described here.)

Timeline for d5oefb1: