![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) ![]() |
![]() | Family d.15.4.0: automated matches [191632] (1 protein) not a true family |
![]() | Protein automated matches [191164] (24 species) not a true protein |
![]() | Species Clostridium pasteurianum [TaxId:1501] [279203] (17 PDB entries) |
![]() | Domain d5oefb1: 5oef B:2-126 [342086] Other proteins in same PDB: d5oefa2, d5oefa3, d5oefb2, d5oefb3 automated match to d3c8ya2 complexed with 9sq, fes, mg, sf4 |
PDB Entry: 5oef (more details), 2.05 Å
SCOPe Domain Sequences for d5oefb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5oefb1 d.15.4.0 (B:2-126) automated matches {Clostridium pasteurianum [TaxId: 1501]} ktiiingvqfntdedttilkfardnnidisalcflnncnndinkceictvevegtglvta cdtliedgmiintnsdavnekiksrisqlldihefkcgpcnrrenceflklvikykaras kpflp
Timeline for d5oefb1: