SCOPe 2.08: Domain d5oefb1: 5oef B:2-126

Lineage for d5oefb1 (5oef B:2-126)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families)

5. Family d.15.4.0: automated matches [191632] (1 protein)
   not a true family

6. Protein automated matches [191164] (24 species)
   not a true protein

7. Species Clostridium pasteurianum [TaxId:1501] [279203] (17 PDB entries)

8. Domain d5oefb1: 5oef B:2-126 [342086]
   Other proteins in same PDB: d5oefa2, d5oefa3, d5oefb2, d5oefb3
   automated match to d3c8ya2
   complexed with 9sq, fes, mg, sf4

Details for d5oefb1

PDB Entry: 5oef, 2.05 Å

PDB Description: active semisynthetic [fefe]-hydrogenase cpi with aza-diselenato- bridged [2fe] cofactor

PDB Compounds: (B:) Iron hydrogenase 1

SCOPe Domain Sequences for d5oefb1:

Sequence; same for both SEQRES and ATOM records:

>d5oefb1 d.15.4.0 (B:2-126) automated matches {Clostridium pasteurianum [TaxId: 1501]}
ktiiingvqfntdedttilkfardnnidisalcflnncnndinkceictvevegtglvta
cdtliedgmiintnsdavnekiksrisqlldihefkcgpcnrrenceflklvikykaras
kpflp

Timeline for d5oefb1:

• d5oefb1 first appeared in SCOPe 2.06
  
• d5oefb1 appears in SCOPe 2.07