Lineage for d1vpt__ (1vpt -)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 588626Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 588627Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (41 families) (S)
  5. 588946Family c.66.1.25: mRNA cap methylase [88785] (2 proteins)
  6. 588951Protein Polymerase regulatory subunit VP39 [53361] (1 species)
  7. 588952Species Vaccinia virus [TaxId:10245] [53362] (17 PDB entries)
  8. 588954Domain d1vpt__: 1vpt - [34207]
    complexed with sam; mutant

Details for d1vpt__

PDB Entry: 1vpt (more details), 1.85 Å

PDB Description: as11 variant of vaccinia virus protein vp39 in complex with s- adenosyl-l-methionine

SCOP Domain Sequences for d1vpt__:

Sequence, based on SEQRES records: (download)

>d1vpt__ c.66.1.25 (-) Polymerase regulatory subunit VP39 {Vaccinia virus}
mdvvsldkpfmyfeeidneldyepesanevakklpyqgqlklllgelfflsklqrhgild
gatvvyigsapgthirylrdhfynlgviikwmlidgrhhdpilnglrdvtlvtrfvdeey
lrsikkqlhpskiilisdvasaaggnepstadllsnyalqnvmisilnpvasslkwrcpf
pdqwikdfyiphgnkmlqpfapsysaemrllsiytgenmrltrvtksdavnyekkmyyln
kivrnkvvvnfdypnqeydyfhmyfmlrtvycnktfpttkakvlflqqsifrflnip

Sequence, based on observed residues (ATOM records): (download)

>d1vpt__ c.66.1.25 (-) Polymerase regulatory subunit VP39 {Vaccinia virus}
mdvvsldkpfmyfeeidneldyepesanevakklpyqgqlklllgelfflsklqrhgild
gatvvyigsapgthirylrdhfynlgviikwmlidgrhhdpilnglrdvtlvtrfvdeey
lrsikkqlhpskiilisdvaspstadllsnyalqnvmisilnpvasslkwrcpfpdqwik
dfyiphgnkmlqpfapsysaemrllsiytgenmrltrvtksdavnyekkmyylnkivrnk
vvvnfdypnqeydyfhmyfmlrtvycnktfpttkakvlflqqsifrflnip

SCOP Domain Coordinates for d1vpt__:

Click to download the PDB-style file with coordinates for d1vpt__.
(The format of our PDB-style files is described here.)

Timeline for d1vpt__: