Lineage for d5m7xd_ (5m7x D:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2962641Fold d.86: eIF4e-like [55417] (1 superfamily)
    beta(2)-alpha-beta(2)-alpha-beta(2)-alpha-beta-2; 2 layers: alpha/beta; antiparallel sheet: 21356478
  4. 2962642Superfamily d.86.1: eIF4e-like [55418] (3 families) (S)
  5. 2962643Family d.86.1.1: Translation initiation factor eIF4e [55419] (1 protein)
    automatically mapped to Pfam PF01652
  6. 2962644Protein Translation initiation factor eIF4e [55420] (3 species)
    messenger RNA 5' cap-binding protein
  7. 2962676Species Mouse (Mus musculus) [TaxId:10090] [55421] (24 PDB entries)
  8. 2962682Domain d5m7xd_: 5m7x D: [342065]
    automated match to d1l8bb_
    protein/RNA complex; complexed with gol, rse

Details for d5m7xd_

PDB Entry: 5m7x (more details), 1.68 Å

PDB Description: translation initiation factor 4e in complex with (rp)-m2(7,2'o)gppsepg mrna 5' cap analog (beta-se-arca d1)
PDB Compounds: (D:) eukaryotic translation initiation factor 4e

SCOPe Domain Sequences for d5m7xd_:

Sequence, based on SEQRES records: (download)

>d5m7xd_ d.86.1.1 (D:) Translation initiation factor eIF4e {Mouse (Mus musculus) [TaxId: 10090]}
pehyikhplqnrwalwffkndksktwqanlrliskfdtvedfwalynhiqlssnlmpgcd
yslfkdgiepmwedeknkrggrwlitlnkqqrrsdldrfwletllcligesfddysddvc
gavvnvrakgdkiaiwttecenrdavthigrvykerlglppkivigyqshadtatksgst
tknrfvv

Sequence, based on observed residues (ATOM records): (download)

>d5m7xd_ d.86.1.1 (D:) Translation initiation factor eIF4e {Mouse (Mus musculus) [TaxId: 10090]}
pehyikhplqnrwalwffkndksktwqanlrliskfdtvedfwalynhiqlssnlmpgcd
yslfkdgiepmwedeknkrggrwlitlnkqqrrsdldrfwletllcligesfddysddvc
gavvnvrakgdkiaiwttecenrdavthigrvykerlglppkivigyqsknrfvv

SCOPe Domain Coordinates for d5m7xd_:

Click to download the PDB-style file with coordinates for d5m7xd_.
(The format of our PDB-style files is described here.)

Timeline for d5m7xd_: