Lineage for d5lo0a_ (5lo0 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2973214Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. 2973215Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) (S)
  5. 2973216Family d.122.1.1: Heat shock protein 90, HSP90, N-terminal domain [55875] (2 proteins)
  6. 2973217Protein HSP90 [55876] (3 species)
  7. 2973319Species Human (Homo sapiens) [TaxId:9606] [55878] (189 PDB entries)
    Uniprot P08238 10-220 # HSP 90-beta isoform ! Uniprot P07900 16-223
  8. 2973525Domain d5lo0a_: 5lo0 A: [342063]
    automated match to d2xjxa_
    complexed with 70n

Details for d5lo0a_

PDB Entry: 5lo0 (more details), 2.3 Å

PDB Description: hsp90 with indazole derivative
PDB Compounds: (A:) Heat shock protein HSP 90-alpha

SCOPe Domain Sequences for d5lo0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5lo0a_ d.122.1.1 (A:) HSP90 {Human (Homo sapiens) [TaxId: 9606]}
vetfafqaeiaqlmsliintfysnkeiflrelisnssdaldkiryesltdpskldsgkel
hinlipnkqdrtltivdtgigmtkadlinnlgtiaksgtkafmealqagadismigqfgv
gfysaylvaekvtvitkhnddeqyawessaggsftvrtdtgepmgrgtkvilhlkedqte
yleerrikeivkkhsqfigypitlfve

SCOPe Domain Coordinates for d5lo0a_:

Click to download the PDB-style file with coordinates for d5lo0a_.
(The format of our PDB-style files is described here.)

Timeline for d5lo0a_: