Lineage for d6eksa3 (6eks A:373-569)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2779906Family b.29.1.8: Vibrio cholerae sialidase, N-terminal and insertion domains [49965] (1 protein)
  6. 2779907Protein Vibrio cholerae sialidase, N-terminal and insertion domains [49966] (2 species)
    both domains have this fold
    rest of protein is beta-propeller of six sheets
  7. 2779908Species Vibrio cholerae [TaxId:243277] [342046] (2 PDB entries)
  8. 2779912Domain d6eksa3: 6eks A:373-569 [342050]
    Other proteins in same PDB: d6eksa2
    automated match to d1kita2
    complexed with ca, g39, gol

Details for d6eksa3

PDB Entry: 6eks (more details), 1.87 Å

PDB Description: vibrio cholerae neuraminidase complexed with oseltamivir carboxylate
PDB Compounds: (A:) sialidase

SCOPe Domain Sequences for d6eksa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d6eksa3 b.29.1.8 (A:373-569) Vibrio cholerae sialidase, N-terminal and insertion domains {Vibrio cholerae [TaxId: 243277]}
dvtdqvkersfqiagwggselyrrntslnsqqdwqsnakirivdgaanqiqvadgsrkyv
vtlsidesgglvanlngvsapiilqsehakvhsfhdyelqysalnhtttlfvdgqqittw
agevsqenniqfgnadaqidgrlhvqkivltqqghnlvefdafylaqqtpevekdleklg
wtkiktgntmslygnas

SCOPe Domain Coordinates for d6eksa3:

Click to download the PDB-style file with coordinates for d6eksa3.
(The format of our PDB-style files is described here.)

Timeline for d6eksa3: