![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
![]() | Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) ![]() |
![]() | Family b.29.1.8: Vibrio cholerae sialidase, N-terminal and insertion domains [49965] (1 protein) |
![]() | Protein Vibrio cholerae sialidase, N-terminal and insertion domains [49966] (2 species) both domains have this fold rest of protein is beta-propeller of six sheets |
![]() | Species Vibrio cholerae [TaxId:243277] [342046] (2 PDB entries) |
![]() | Domain d6eksa3: 6eks A:373-569 [342050] Other proteins in same PDB: d6eksa2 automated match to d1kita2 complexed with ca, g39, gol |
PDB Entry: 6eks (more details), 1.87 Å
SCOPe Domain Sequences for d6eksa3:
Sequence; same for both SEQRES and ATOM records: (download)
>d6eksa3 b.29.1.8 (A:373-569) Vibrio cholerae sialidase, N-terminal and insertion domains {Vibrio cholerae [TaxId: 243277]} dvtdqvkersfqiagwggselyrrntslnsqqdwqsnakirivdgaanqiqvadgsrkyv vtlsidesgglvanlngvsapiilqsehakvhsfhdyelqysalnhtttlfvdgqqittw agevsqenniqfgnadaqidgrlhvqkivltqqghnlvefdafylaqqtpevekdleklg wtkiktgntmslygnas
Timeline for d6eksa3: