Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) |
Family c.66.1.8: Chemotaxis receptor methyltransferase CheR, C-terminal domain [53357] (1 protein) contains additional N-terminal all-alpha domain, res. 11-91 automatically mapped to Pfam PF01739 |
Protein Chemotaxis receptor methyltransferase CheR, C-terminal domain [53358] (1 species) |
Species Salmonella typhimurium [TaxId:90371] [53359] (2 PDB entries) |
Domain d1bc5a2: 1bc5 A:92-284 [34204] Other proteins in same PDB: d1bc5a1 complexed with co, sah |
PDB Entry: 1bc5 (more details), 2.2 Å
SCOPe Domain Sequences for d1bc5a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bc5a2 c.66.1.8 (A:92-284) Chemotaxis receptor methyltransferase CheR, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} nltaffreahhfpilaeharrrhgeyrvwsaaastgeepysiaitladalgmapgrwkvf asdidtevlekarsgiyrlselktlspqqlqryfmrgtgpheglvrvrqelanyvefssv nllekqynvpgpfdaifcrnvmiyfdkttqedilrrfvpllkpdgllfaghsenfsnlvr efslrgqtvyals
Timeline for d1bc5a2: