SCOPe 2.08: Domain d1bc5a2: 1bc5 A:92-284

Lineage for d1bc5a2 (1bc5 A:92-284)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest

4. Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families)

5. Family c.66.1.8: Chemotaxis receptor methyltransferase CheR, C-terminal domain [53357] (1 protein)
   contains additional N-terminal all-alpha domain, res. 11-91
   automatically mapped to Pfam PF01739

6. Protein Chemotaxis receptor methyltransferase CheR, C-terminal domain [53358] (1 species)

7. Species Salmonella typhimurium [TaxId:90371] [53359] (2 PDB entries)

8. Domain d1bc5a2: 1bc5 A:92-284 [34204]
   Other proteins in same PDB: d1bc5a1
   complexed with co, sah

Details for d1bc5a2

PDB Entry: 1bc5, 2.2 Å

PDB Description: chemotaxis receptor recognition by protein methyltransferase cher

PDB Compounds: (A:) chemotaxis receptor methyltransferase

SCOPe Domain Sequences for d1bc5a2:

Sequence; same for both SEQRES and ATOM records:

>d1bc5a2 c.66.1.8 (A:92-284) Chemotaxis receptor methyltransferase CheR, C-terminal domain {Salmonella typhimurium [TaxId: 90371]}
nltaffreahhfpilaeharrrhgeyrvwsaaastgeepysiaitladalgmapgrwkvf
asdidtevlekarsgiyrlselktlspqqlqryfmrgtgpheglvrvrqelanyvefssv
nllekqynvpgpfdaifcrnvmiyfdkttqedilrrfvpllkpdgllfaghsenfsnlvr
efslrgqtvyals

Timeline for d1bc5a2:

• d1bc5a2 first appeared (with stable ids) in SCOP 1.55
  
• d1bc5a2 appears in SCOPe 2.07