Lineage for d6amxa1 (6amx A:2-235)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2123292Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2123293Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2128217Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2128218Protein automated matches [190123] (130 species)
    not a true protein
  7. 2128241Species Aquifex aeolicus [TaxId:224324] [188217] (15 PDB entries)
  8. 2128257Domain d6amxa1: 6amx A:2-235 [342033]
    Other proteins in same PDB: d6amxa2
    automated match to d4wbsb_
    complexed with pe5

Details for d6amxa1

PDB Entry: 6amx (more details), 2.05 Å

PDB Description: crystal structure of nucelotide binding domain of o-antigen polysaccharide abc-transporter
PDB Compounds: (A:) ABC transporter

SCOPe Domain Sequences for d6amxa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6amxa1 c.37.1.0 (A:2-235) automated matches {Aquifex aeolicus [TaxId: 224324]}
irvfdvwkkykyykkpqdrlkeiifrkpfheelwvlkginleiekgevlgivgpngagks
tllkvitgvtepdkgfversgkvvgllelgtgfnyelsgleniyvnasllglsrreidek
lesiiefselddfinkplktyssgmimrlafsiaihtepecfiidealavgdahfqqkcf
rklkehkqkggsiifvshdmnavkilcdraillhkgeiieegspetvtqayykl

SCOPe Domain Coordinates for d6amxa1:

Click to download the PDB-style file with coordinates for d6amxa1.
(The format of our PDB-style files is described here.)

Timeline for d6amxa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6amxa2