Lineage for d5y02d_ (5y02 D:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2192663Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2193227Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) (S)
    dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers
  5. 2193599Family d.58.4.0: automated matches [191316] (1 protein)
    not a true family
  6. 2193600Protein automated matches [190081] (27 species)
    not a true protein
  7. 2193754Species Passiflora edulis [TaxId:78168] [341952] (3 PDB entries)
  8. 2193758Domain d5y02d_: 5y02 D: [342014]
    Other proteins in same PDB: d5y02c2
    automated match to d1tr0a_
    complexed with hbx, hez, mxn; mutant

Details for d5y02d_

PDB Entry: 5y02 (more details), 1.8 Å

PDB Description: c-terminal peptide depleted mutant of hydroxynitrile lyase from passiflora edulis (pehnl) bound with (r)-mandelonitrile
PDB Compounds: (D:) hydroxynitrile lyase

SCOPe Domain Sequences for d5y02d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5y02d_ d.58.4.0 (D:) automated matches {Passiflora edulis [TaxId: 78168]}
ppeivrhivfnryksqlsqkqidqiiadygnlqniapemkewkwgtdlgpavedradgft
hayestfhsvadflnffysppalefakeffpacekivvlnyiine

SCOPe Domain Coordinates for d5y02d_:

Click to download the PDB-style file with coordinates for d5y02d_.
(The format of our PDB-style files is described here.)

Timeline for d5y02d_: