Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers |
Family d.58.4.0: automated matches [191316] (1 protein) not a true family |
Protein automated matches [190081] (27 species) not a true protein |
Species Passiflora edulis [TaxId:78168] [341952] (3 PDB entries) |
Domain d5xzqi_: 5xzq I: [341989] automated match to d1tr0a_ |
PDB Entry: 5xzq (more details), 2.8 Å
SCOPe Domain Sequences for d5xzqi_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5xzqi_ d.58.4.0 (I:) automated matches {Passiflora edulis [TaxId: 78168]} peivrhivfnryksqlsqkqidqiiadygnlqniapemkewkwgtdlgpavedradgfth ayestfhsvadflnffysppalefakeffpacekivvlnyiinetfp
Timeline for d5xzqi_: