SCOPe 2.08: Domain d5xztc1: 5xzt C:1-106

Lineage for d5xztc1 (5xzt C:1-106)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families)
   dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers

5. Family d.58.4.0: automated matches [191316] (1 protein)
   not a true family

6. Protein automated matches [190081] (33 species)
   not a true protein

7. Species Passiflora edulis [TaxId:78168] [341952] (3 PDB entries)

8. Domain d5xztc1: 5xzt C:1-106 [341961]
   Other proteins in same PDB: d5xztc2, d5xzth2
   automated match to d1tr0a_
   complexed with hez; mutant

Details for d5xztc1

PDB Entry: 5xzt, 1.8 Å

PDB Description: c-terminal peptide depleted mutant of hydroxynitrile lyase from passiflora edulis (pehnl)

PDB Compounds: (C:) hydroxynitrile lyase

SCOPe Domain Sequences for d5xztc1:

Sequence; same for both SEQRES and ATOM records:

>d5xztc1 d.58.4.0 (C:1-106) automated matches {Passiflora edulis [TaxId: 78168]}
nppeivrhivfnryksqlsqkqidqiiadygnlqniapemkewkwgtdlgpavedradgf
thayestfhsvadflnffysppalefakeffpacekivvlnyiine

Timeline for d5xztc1:

• d5xztc1 first appeared in SCOPe 2.06
  
• d5xztc1 appears in SCOPe 2.07