Lineage for d5xzte_ (5xzt E:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2949708Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) (S)
    dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers
  5. 2950158Family d.58.4.0: automated matches [191316] (1 protein)
    not a true family
  6. 2950159Protein automated matches [190081] (33 species)
    not a true protein
  7. 2950362Species Passiflora edulis [TaxId:78168] [341952] (3 PDB entries)
  8. 2950379Domain d5xzte_: 5xzt E: [341959]
    Other proteins in same PDB: d5xztc2, d5xzth2
    automated match to d1tr0a_
    complexed with hez; mutant

Details for d5xzte_

PDB Entry: 5xzt (more details), 1.8 Å

PDB Description: c-terminal peptide depleted mutant of hydroxynitrile lyase from passiflora edulis (pehnl)
PDB Compounds: (E:) hydroxynitrile lyase

SCOPe Domain Sequences for d5xzte_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5xzte_ d.58.4.0 (E:) automated matches {Passiflora edulis [TaxId: 78168]}
ppeivrhivfnryksqlsqkqidqiiadygnlqniapemkewkwgtdlgpavedradgft
hayestfhsvadflnffysppalefakeffpacekivvlnyiine

SCOPe Domain Coordinates for d5xzte_:

Click to download the PDB-style file with coordinates for d5xzte_.
(The format of our PDB-style files is described here.)

Timeline for d5xzte_: