SCOPe 2.07: Domain d5x14a1: 5x14 A:1-182

Lineage for d5x14a1 (5x14 A:1-182)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.0: automated matches [191329] (1 protein)
   not a true family

6. Protein automated matches [190154] (87 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:655816] [341938] (5 PDB entries)

8. Domain d5x14a1: 5x14 A:1-182 [341942]
   Other proteins in same PDB: d5x14a2
   automated match to d1yg2a_
   complexed with fer, gol

Details for d5x14a1

PDB Entry: 5x14, 1.68 Å

PDB Description: crystal structure of bacillus subtilis padr in complex with ferulic acid

PDB Compounds: (A:) Transcriptional regulator

SCOPe Domain Sequences for d5x14a1:

Sequence, based on SEQRES records:

>d5x14a1 a.4.5.0 (A:1-182) automated matches {Bacillus subtilis [TaxId: 655816]}
mrvlkyailgllrkgelsgyditsyfkeelgqfwsakhsqiypelkkltdegfitfrtti
qgtklekkmytltdsgkqelhdwlirhqpipetvkdefmlkayfisslsrqeasdlftdq
llkrkaklsdlqgsyeklmasaepmsfsspdfghylvltkalereknyvswlesilamid
ed

Sequence, based on observed residues (ATOM records):

>d5x14a1 a.4.5.0 (A:1-182) automated matches {Bacillus subtilis [TaxId: 655816]}
mrvlkyailgllrkgelsgyditsyfkeelgqfwsakhsqiypelkkltdegfitfrkkm
ytltdsgkqelhdwlirhqpipetvkdefmlkayfisslsrqeasdlftdqllkrkakls
dlqgsyeklmasaepmsfsspdfghylvltkalereknyvswlesilamided

Timeline for d5x14a1:

• d5x14a1 first appeared in SCOPe 2.06
  
• d5x14a1 appears in the current release, SCOPe 2.08