![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
![]() | Superfamily a.118.8: TPR-like [48452] (10 families) ![]() |
![]() | Family a.118.8.1: Tetratricopeptide repeat (TPR) [48453] (21 proteins) this is a repeat family; one repeat unit is 1zb1 A:166-231 found in domain |
![]() | Protein Lipoprotein NlpI [117009] (2 species) |
![]() | Species Escherichia coli [TaxId:83333] [341925] (1 PDB entry) |
![]() | Domain d5wqlb_: 5wql B: [341937] Other proteins in same PDB: d5wqla2 automated match to d1xnfb_ |
PDB Entry: 5wql (more details), 2.3 Å
SCOPe Domain Sequences for d5wqlb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5wqlb_ a.118.8.1 (B:) Lipoprotein NlpI {Escherichia coli [TaxId: 83333]} ntswrksevlavplqptlqqevilarmeqilasraltdderaqllyergvlydslglral arndfsqalairpdmpevfnylgiyltqagnfdaayeafdsvleldptynyahlnrgial yyggrdklaqddllafyqddpndpfrslwlylaeqkldekqakevlkqhfeksdkeqwgw nivefylgniseqtlmerlkadatdntslaehlsetnfylgkyylslgdldsatalfkla vannvhnfvehryallelsllgqdqddl
Timeline for d5wqlb_: