SCOPe 2.06: Domain d5wqlb_: 5wql B:

Lineage for d5wqlb_ (5wql B:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.8: TPR-like [48452] (9 families)

5. Family a.118.8.1: Tetratricopeptide repeat (TPR) [48453] (20 proteins)
   this is a repeat family; one repeat unit is 1zb1 A:166-231 found in domain

6. Protein Lipoprotein NlpI [117009] (2 species)

7. Species Escherichia coli [TaxId:83333] [341925] (1 PDB entry)

8. Domain d5wqlb_: 5wql B: [341937]
   Other proteins in same PDB: d5wqla2
   automated match to d1xnfb_

Details for d5wqlb_

PDB Entry: 5wql, 2.3 Å

PDB Description: structure of a pdz-protease bound to a substrate-binding adaptor

PDB Compounds: (B:) Lipoprotein nlpI

SCOPe Domain Sequences for d5wqlb_:

Sequence; same for both SEQRES and ATOM records:

>d5wqlb_ a.118.8.1 (B:) Lipoprotein NlpI {Escherichia coli [TaxId: 83333]}
ntswrksevlavplqptlqqevilarmeqilasraltdderaqllyergvlydslglral
arndfsqalairpdmpevfnylgiyltqagnfdaayeafdsvleldptynyahlnrgial
yyggrdklaqddllafyqddpndpfrslwlylaeqkldekqakevlkqhfeksdkeqwgw
nivefylgniseqtlmerlkadatdntslaehlsetnfylgkyylslgdldsatalfkla
vannvhnfvehryallelsllgqdqddl

Timeline for d5wqlb_:

• d5wqlb_ is new in SCOPe 2.06-stable
  
• d5wqlb_ appears in SCOPe 2.07
  
• d5wqlb_ appears in the current release, SCOPe 2.08