Lineage for d4wwhb_ (4wwh B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2912917Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    parallel beta-sheet of 6 strands, order 213456
  4. 2912918Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) (S)
    Similar in architecture to the superfamily II but partly differs in topology
  5. 2913229Family c.93.1.0: automated matches [191439] (1 protein)
    not a true family
  6. 2913230Protein automated matches [190646] (77 species)
    not a true protein
  7. 2913463Species Mycobacterium smegmatis [TaxId:246196] [232714] (3 PDB entries)
  8. 2913465Domain d4wwhb_: 4wwh B: [341935]
    automated match to d4ywhb_
    complexed with gal, trs

Details for d4wwhb_

PDB Entry: 4wwh (more details), 1.2 Å

PDB Description: crystal structure of an abc transporter solute binding protein (ipr025997) from mycobacterium smegmatis (msmeg_1704, target efi- 510967) with bound d-galactose
PDB Compounds: (B:) ABC transporter

SCOPe Domain Sequences for d4wwhb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4wwhb_ c.93.1.0 (B:) automated matches {Mycobacterium smegmatis [TaxId: 246196]}
akgtvgiamptksserwvadgqnmvdqfkafgydtdlqygddvvqnqvsqienmitkgvk
llviapidgssltntlqhaadlkipvisydrlikgtpnvdyyatfdntkvgvlqanyivd
tlgvadgkgpfnlelfagspddnnatyffqgamsvlqpyidsgklvvksgqttfdqiatl
rwdgglaqsrmdnllsqaytsgrvdavlspydgisrgvisalksagygnaakplpivtgq
daelasvksivageqtqtvfkdtrelakaavqeadavltggtpqvndtetydngvkvvps
ylldpvsvdksnykkvlidsgyytetqvq

SCOPe Domain Coordinates for d4wwhb_:

Click to download the PDB-style file with coordinates for d4wwhb_.
(The format of our PDB-style files is described here.)

Timeline for d4wwhb_: