Lineage for d1d2hc_ (1d2h C:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2500487Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2500488Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2500724Family c.66.1.5: Glycine N-methyltransferase [53348] (1 protein)
  6. 2500725Protein Glycine N-methyltransferase [53349] (3 species)
  7. 2500742Species Norway rat (Rattus norvegicus) [TaxId:10116] [53350] (12 PDB entries)
  8. 2500781Domain d1d2hc_: 1d2h C: [34193]
    complexed with sah; mutant

Details for d1d2hc_

PDB Entry: 1d2h (more details), 3 Å

PDB Description: crystal structure of r175k mutant glycine n-methyltransferase complexed with s-adenosylhomocysteine
PDB Compounds: (C:) glycine n-methyltransferase

SCOPe Domain Sequences for d1d2hc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d2hc_ c.66.1.5 (C:) Glycine N-methyltransferase {Norway rat (Rattus norvegicus) [TaxId: 10116]}
taeykawllgllrqhgchrvldvacgtgvdsimlveegfsvtsvdasdkmlkyalkerwn
rrkepafdkwvieeanwltldkdvpagdgfdaviclgnsfahlpdskgdqsehrlalkni
asmvrpggllvidhknydyilstgcappgkniyyksdltkdittsvltvnnkahmvtldy
tvqvpgagrdgapgfskfrlsyyphclasftelvqeafggrcqhsvlgdfkpyrpgqayv
pcyfihvlkktg

SCOPe Domain Coordinates for d1d2hc_:

Click to download the PDB-style file with coordinates for d1d2hc_.
(The format of our PDB-style files is described here.)

Timeline for d1d2hc_: