Class b: All beta proteins [48724] (177 folds) |
Fold b.61: Streptavidin-like [50875] (8 superfamilies) barrel, closed; n=8, S=10; meander |
Superfamily b.61.1: Avidin/streptavidin [50876] (2 families) |
Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins) |
Protein automated matches [190191] (2 species) not a true protein |
Species Streptomyces avidinii [TaxId:1895] [189343] (50 PDB entries) |
Domain d5wbda1: 5wbd A:14-134 [341923] Other proteins in same PDB: d5wbda2 automated match to d2bc3b_ complexed with act, si7 |
PDB Entry: 5wbd (more details), 1.5 Å
SCOPe Domain Sequences for d5wbda1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5wbda1 b.61.1.1 (A:14-134) automated matches {Streptomyces avidinii [TaxId: 1895]} eagitgtwynqlgstfivtagadgaltgtyesavgaaesryvltgrydsapatdgsgtal gwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftkv k
Timeline for d5wbda1: