SCOPe 2.07: Domain d5wbaa1: 5wba A:14-134

Lineage for d5wbaa1 (5wba A:14-134)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.61: Streptavidin-like [50875] (8 superfamilies)
   barrel, closed; n=8, S=10; meander

4. Superfamily b.61.1: Avidin/streptavidin [50876] (2 families)

5. Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins)

6. Protein automated matches [190191] (2 species)
   not a true protein

7. Species Streptomyces avidinii [TaxId:1895] [189343] (98 PDB entries)

8. Domain d5wbaa1: 5wba A:14-134 [341917]
   Other proteins in same PDB: d5wbaa2
   automated match to d2bc3b_
   complexed with act, cu, si8, so4

Details for d5wbaa1

PDB Entry: 5wba, 1.5 Å

PDB Description: peroxide activation regulated by hydrogen bonds within artificial cu proteins - wt

PDB Compounds: (A:) streptavidin

SCOPe Domain Sequences for d5wbaa1:

Sequence; same for both SEQRES and ATOM records:

>d5wbaa1 b.61.1.1 (A:14-134) automated matches {Streptomyces avidinii [TaxId: 1895]}
eagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgtal
gwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftkv
k

Timeline for d5wbaa1:

• d5wbaa1 first appeared in SCOPe 2.06
  
• d5wbaa1 appears in the current release, SCOPe 2.08