SCOPe 2.06: Domain d3w90a_: 3w90 A:

Lineage for d3w90a_ (3w90 A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (130 species)
   not a true protein

7. Species Thermus thermophilus HB8 [TaxId:300852] [189850] (10 PDB entries)

8. Domain d3w90a_: 3w90 A: [341914]
   automated match to d3akea_

Details for d3w90a_

PDB Entry: 3w90, 1.65 Å

PDB Description: crystal structure of cmp kinase from thermus thermophilus hb8

PDB Compounds: (A:) Cytidylate kinase

SCOPe Domain Sequences for d3w90a_:

Sequence, based on SEQRES records:

>d3w90a_ c.37.1.0 (A:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
givtidgpsasgkssvarrvaaalgvpylssgllyraaaflalragvdpgdeegllalle
glgvrllaqaegnrvladgedltsflhtpevdrvvsavarlpgvrawvnrrlkevpppfv
aegrdmgtavfpeaahkfyltaspevrawrrarerpqayeevlrdllrrderdkaqsapa
pdalvldtggmtldevvawvlahir

Sequence, based on observed residues (ATOM records):

>d3w90a_ c.37.1.0 (A:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
givtidgpsasgkssvarrvaaalgvpylssgllyraaaflalragvegllalleglgvr
llaqaegnrvladgedltsflhtpevdrvvsavarlpgvrawvnrrlkevpppfvaegrd
mgtavfpeaahkfyltaspevrawrrareqayeevlrdllrrderdkaqsapapdalvld
tggmtldevvawvlahir

Timeline for d3w90a_:

• d3w90a_ is new in SCOPe 2.06-stable
  
• d3w90a_ appears in SCOPe 2.07
  
• d3w90a_ appears in the current release, SCOPe 2.08