SCOPe 2.07: Domain d5w3ra1: 5w3r A:519-628

Lineage for d5w3ra1 (5w3r A:519-628)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.93: SH2-like [55549] (1 superfamily)
   3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices

4. Superfamily d.93.1: SH2 domain [55550] (2 families)

5. Family d.93.1.1: SH2 domain [55551] (35 proteins)
   Pfam PF00017

6. Protein automated matches [190202] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186949] (18 PDB entries)

8. Domain d5w3ra1: 5w3r A:519-628 [341911]
   Other proteins in same PDB: d5w3ra2
   automated match to d2hdvb_
   complexed with iph, po4

Details for d5w3ra1

PDB Entry: 5w3r, 1.39 Å

PDB Description: sh2b1 sh2 domain

PDB Compounds: (A:) SH2B adapter protein 1

SCOPe Domain Sequences for d5w3ra1:

Sequence; same for both SEQRES and ATOM records:

>d5w3ra1 d.93.1.1 (A:519-628) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dqplsgypwfhgmlsrlkaaqlvltggtgshgvflvrqsetrrgeyvltfnfqgkakhlr
lslnaagqcrvqhlhfqsifdmlehfrvhpiplesggssdvvlvsyvpss

Timeline for d5w3ra1:

• d5w3ra1 first appeared in SCOPe 2.06
  
• d5w3ra1 appears in the current release, SCOPe 2.08