Lineage for d5w3ra1 (5w3r A:519-628)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2965227Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices
  4. 2965228Superfamily d.93.1: SH2 domain [55550] (2 families) (S)
  5. 2965229Family d.93.1.1: SH2 domain [55551] (35 proteins)
    Pfam PF00017
  6. 2965668Protein automated matches [190202] (2 species)
    not a true protein
  7. 2965669Species Human (Homo sapiens) [TaxId:9606] [186949] (18 PDB entries)
  8. 2965671Domain d5w3ra1: 5w3r A:519-628 [341911]
    Other proteins in same PDB: d5w3ra2
    automated match to d2hdvb_
    complexed with iph, po4

Details for d5w3ra1

PDB Entry: 5w3r (more details), 1.39 Å

PDB Description: sh2b1 sh2 domain
PDB Compounds: (A:) SH2B adapter protein 1

SCOPe Domain Sequences for d5w3ra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5w3ra1 d.93.1.1 (A:519-628) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dqplsgypwfhgmlsrlkaaqlvltggtgshgvflvrqsetrrgeyvltfnfqgkakhlr
lslnaagqcrvqhlhfqsifdmlehfrvhpiplesggssdvvlvsyvpss

SCOPe Domain Coordinates for d5w3ra1:

Click to download the PDB-style file with coordinates for d5w3ra1.
(The format of our PDB-style files is described here.)

Timeline for d5w3ra1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5w3ra2