![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.9: IL8-like [54116] (2 superfamilies) beta(3)-alpha |
![]() | Superfamily d.9.1: Interleukin 8-like chemokines [54117] (2 families) ![]() form dimers with different dimerisation modes |
![]() | Family d.9.1.1: Interleukin 8-like chemokines [54118] (25 proteins) |
![]() | Protein automated matches [190403] (4 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187277] (20 PDB entries) |
![]() | Domain d5ur7b_: 5ur7 B: [341909] automated match to d1ha6a_ complexed with act, ipa |
PDB Entry: 5ur7 (more details), 2 Å
SCOPe Domain Sequences for d5ur7b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ur7b_ d.9.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} dcclgytdrilhpkfivgftrqlanegcdinaiifhtkkklsvcanpkqtwvkyivrllc kkvknm
Timeline for d5ur7b_: