![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
![]() | Superfamily b.6.1: Cupredoxins [49503] (8 families) ![]() contains copper-binding site |
![]() | Family b.6.1.2: Periplasmic domain of cytochrome c oxidase subunit II [49541] (3 proteins) |
![]() | Protein Cytochrome c oxidase [49544] (4 species) |
![]() | Species Thermus thermophilus, ba3 type [TaxId:274] [49547] (37 PDB entries) |
![]() | Domain d5u7nf_: 5u7n F: [341908] automated match to d2llna_ complexed with cu, mpd |
PDB Entry: 5u7n (more details), 2.3 Å
SCOPe Domain Sequences for d5u7nf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5u7nf_ b.6.1.2 (F:) Cytochrome c oxidase {Thermus thermophilus, ba3 type [TaxId: 274]} pttvrqegpwadpaqavvqtgpnqytvyvlafafgyqpnpievpqgaeivfkitspdvih gfhvegtninvevlpgevstvrytfkrpgeyriictphpfmfgtivvke
Timeline for d5u7nf_: