![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest |
![]() | Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) ![]() |
![]() | Family c.71.1.0: automated matches [191485] (1 protein) not a true family |
![]() | Protein automated matches [190777] (28 species) not a true protein |
![]() | Species Escherichia coli [TaxId:562] [267778] (7 PDB entries) |
![]() | Domain d5uipb1: 5uip B:2-159 [341906] Other proteins in same PDB: d5uipa2, d5uipb2 automated match to d2w9ta_ complexed with 8dm, lg3, na, nap |
PDB Entry: 5uip (more details), 1.9 Å
SCOPe Domain Sequences for d5uipb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5uipb1 c.71.1.0 (B:2-159) automated matches {Escherichia coli [TaxId: 562]} isliaalavdrvigmenampwnlpadlawfkrntlnkpvimgrhtwesigrplpgrknii lssqpgtddrvtwvksvdeaiaacgdvpeimvigggrvyeqflpkaqklylthidaeveg dthfpdyepddwesvfsefhdadaqnshsysfeilerr
Timeline for d5uipb1: