Lineage for d5uhxa1 (5uhx A:48-365)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2413227Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2416558Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2418840Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 2418841Protein automated matches [190075] (97 species)
    not a true protein
  7. 2419587Species uncultured organism [TaxId:155900] [341902] (1 PDB entry)
  8. 2419588Domain d5uhxa1: 5uhx A:48-365 [341903]
    Other proteins in same PDB: d5uhxa2
    automated match to d1qi2a_
    complexed with 1pe, edo, mes

Details for d5uhxa1

PDB Entry: 5uhx (more details), 1.57 Å

PDB Description: structure of cellulase cel5c_1
PDB Compounds: (A:) Carbohydrate-active enzyme

SCOPe Domain Sequences for d5uhxa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5uhxa1 c.1.8.0 (A:48-365) automated matches {uncultured organism [TaxId: 155900]}
typegspvyhngklsvqgtqmvsecgkpvqlrgmsshglawfpkcyteasltalvkdwni
difrlaiythewggyttnqwkskddynayidnmvdicaklgiyciidwhvlndgsgdpny
tlddaipfwdymsakhkddkhvlyeicnepngfdvkwadvkeyaeavipvirkndpdkii
icgtptwsqdvdlaaqdplsydnvmytlhfysgthtqylrdkaqvainkglalfvtefgt
tqasgdggvyfdecntwmdwmdarkiswvnwsfadkpessaalkpgasnsgdwnmvsesg
qyikrklsqpksyescgg

SCOPe Domain Coordinates for d5uhxa1:

Click to download the PDB-style file with coordinates for d5uhxa1.
(The format of our PDB-style files is described here.)

Timeline for d5uhxa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5uhxa2