Class b: All beta proteins [48724] (177 folds) |
Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (8 families) contains copper-binding site |
Family b.6.1.2: Periplasmic domain of cytochrome c oxidase subunit II [49541] (3 proteins) |
Protein Cytochrome c oxidase [49544] (4 species) |
Species Thermus thermophilus, ba3 type [TaxId:274] [49547] (35 PDB entries) |
Domain d5u7nh_: 5u7n H: [341900] automated match to d2llna_ complexed with cu, mpd |
PDB Entry: 5u7n (more details), 2.3 Å
SCOPe Domain Sequences for d5u7nh_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5u7nh_ b.6.1.2 (H:) Cytochrome c oxidase {Thermus thermophilus, ba3 type [TaxId: 274]} lervdpttvrqegpwadpaqavvqtgpnqytvyvlafafgyqpnpievpqgaeivfkits pdvihgfhvegtninvevlpgevstvrytfkrpgeyriictphpfmfgtivvke
Timeline for d5u7nh_: