Lineage for d5uiod_ (5uio D:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2903429Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest
  4. 2903430Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) (S)
  5. 2904032Family c.71.1.0: automated matches [191485] (1 protein)
    not a true family
  6. 2904033Protein automated matches [190777] (28 species)
    not a true protein
  7. 2904182Species Escherichia coli [TaxId:562] [267778] (7 PDB entries)
  8. 2904190Domain d5uiod_: 5uio D: [341895]
    automated match to d3tq9a_
    complexed with 8dm, bme, fmt, lg3, nap

Details for d5uiod_

PDB Entry: 5uio (more details), 1.93 Å

PDB Description: structure of dhfr with bound dap, p-abg and nadp
PDB Compounds: (D:) dihydrofolate reductase

SCOPe Domain Sequences for d5uiod_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5uiod_ c.71.1.0 (D:) automated matches {Escherichia coli [TaxId: 562]}
mmisliaalavdrvigmenampwnlpadlawfkrntlnkpvimgrhtwesigrplpgrkn
iilssqpgtddrvtwvksvdeaiaacgdvpeimvigggrvyeqflpkaqklylthidaev
egdthfpdyepddwesvfsefhdadaqnshsycfeilerr

SCOPe Domain Coordinates for d5uiod_:

Click to download the PDB-style file with coordinates for d5uiod_.
(The format of our PDB-style files is described here.)

Timeline for d5uiod_: