Lineage for d5tv1a1 (5tv1 A:8-176)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2765063Superfamily b.1.18: E set domains [81296] (27 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2766140Family b.1.18.0: automated matches [191341] (1 protein)
    not a true family
  6. 2766141Protein automated matches [190226] (81 species)
    not a true protein
  7. 2766195Species Cow (Bos taurus) [TaxId:9913] [231496] (3 PDB entries)
  8. 2766196Domain d5tv1a1: 5tv1 A:8-176 [341883]
    automated match to d3p2da1
    complexed with gol, ihp

Details for d5tv1a1

PDB Entry: 5tv1 (more details), 2.4 Å

PDB Description: active arrestin-3 with inositol hexakisphosphate
PDB Compounds: (A:) Beta-arrestin-2

SCOPe Domain Sequences for d5tv1a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5tv1a1 b.1.18.0 (A:8-176) automated matches {Cow (Bos taurus) [TaxId: 9913]}
rvfkksspnckltvylgkrdfvdhldkvdpvdgvvlvdpdylkdrkvfvtltcafrygre
dldvlglsfrkdlfianyqafpptpnpprpptrlqerllrklgqhahpffftipqnlpcs
vtlqpgpedtgkacgvdfeirafcaksleekshkrnsvrlvirkvqfap

SCOPe Domain Coordinates for d5tv1a1:

Click to download the PDB-style file with coordinates for d5tv1a1.
(The format of our PDB-style files is described here.)

Timeline for d5tv1a1: