![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
![]() | Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) ![]() shares functional and structural similarities with the ATP-grasp fold and PIPK |
![]() | Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins) members organized in the groups and subfamiles specified by the comments |
![]() | Protein Protein kinase CK2, alpha subunit [56142] (3 species) CMGC group; CK2 subfamily; serine/threonine kinase |
![]() | Species Human (Homo sapiens) [TaxId:9606] [75559] (184 PDB entries) |
![]() | Domain d5t1ha_: 5t1h A: [341882] automated match to d3h30a_ complexed with 75e, edo, so4 |
PDB Entry: 5t1h (more details), 2.11 Å
SCOPe Domain Sequences for d5t1ha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5t1ha_ d.144.1.7 (A:) Protein kinase CK2, alpha subunit {Human (Homo sapiens) [TaxId: 9606]} sgpvpsrarvytdvnthrpreywdyeshvvewgnqddyqlvrklgrgkysevfeainitn nekvvvkilkpvkkkkikreikilenlrggpniitladivkdpvsrtpalvfehvnntdf kqlyqtltdydirfymyeilkaldychsmgimhrdvkphnvmidhehrklrlidwglaef yhpgqeynvrvasryfkgpellvdyqmydysldmwslgcmlasmifrkepffhghdnydq lvriakvlgtedlydyidkynieldprfndilgrhsrkrwerfvhsenqhlvspealdfl dkllrydhqsrltareamehpyfytvvkdqa
Timeline for d5t1ha_: