![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
![]() | Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) ![]() |
![]() | Family c.66.1.1: COMT-like [53336] (4 proteins) |
![]() | Protein Catechol O-methyltransferase, COMT [53337] (2 species) |
![]() | Species Norway rat (Rattus norvegicus) [TaxId:10116] [53338] (87 PDB entries) |
![]() | Domain d5p9oa_: 5p9o A: [341848] automated match to d4pyna_ complexed with 7jf, cl, dtd, mg, nhe, sah, so4 |
PDB Entry: 5p9o (more details), 1.1 Å
SCOPe Domain Sequences for d5p9oa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5p9oa_ c.66.1.1 (A:) Catechol O-methyltransferase, COMT {Norway rat (Rattus norvegicus) [TaxId: 10116]} dtkeqrilryvqqnakpgdpqsvleaidtyctqkewamnvgdakgqimdavireyspslv lelgaycgysavrmarllqpgarlltmeinpdcaaitqqmlnfaglqdkvtilngasqdl ipqlkkkydvdtldmvfldhwkdrylpdtlllekcgllrkgtvlladnvivpgtpdflay vrgsssfecthyssyleymkvvdglekaiyqgp
Timeline for d5p9oa_: